Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R1ZVV1
dbSWEET id: dbswt_1483
Accession: A0A0R1ZVV1
Uniprot status: Unreviewed
Organism: Lactobacillus sharpeae
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 104
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1ZVV1|A0A0R1ZVV1_9LACO|Unreviewed|Lactobacillus sharpeae| 104
MRIDTSKYPEGKEAVDPKRVRRLKILSKVATIMCISMYISYIPQIIANFSGNPVSPLQPL
VAAVNATLWVGYGWSKTYKDWPVIISNLPGIVFGLVTVITVYIH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 27 Model end: 102 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1ZVV1_inward.pdb Alignment file: A0A0R1ZVV1_inw.pir Procheck score ⇒ Ramachandran plot: 91.1% favored 5.6% allowed 2.4% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1ZVV1_outward.pdb Alignment file: A0A0R1ZVV1_out.pir Procheck score ⇒ Ramachandran plot: 93.5% favored 4.8% allowed 1.6% week .0% disallowed Occluded: Model structure: A0A0R1ZVV1_occluded.pdb Alignment file: A0A0R1ZVV1_occ.pir Procheck score ⇒ Ramachandran plot: 91.1% favored 7.3% allowed .0% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA