Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R1YTE5
dbSWEET id: dbswt_1990
Accession: A0A0R1YTE5
Uniprot status: Unreviewed
Organism: Lactobacillus parafarraginis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 115
Substrate Binding Site: ADAD CVV: 316 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1YTE5|A0A0R1YTE5_9LACO|Unreviewed|Lactobacillus parafarraginis| 115
MESFDIQFRLNTPQGQLKETASHRLHHTKHAIDEEKVVGDLATIANMIMYVSYISQIIEN
LNGNPTPPIQPLCAAINAALWTWYGWVKPKRDWILIVADVPGVIFGVLTAVTAVI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 39 Model end: 115 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1YTE5_inward.pdb Alignment file: A0A0R1YTE5_inw.pir Procheck score ⇒ Ramachandran plot: 89.1% favored 9.4% allowed .8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1YTE5_outward.pdb Alignment file: A0A0R1YTE5_out.pir Procheck score ⇒ Ramachandran plot: 93.0% favored 5.5% allowed .8% week .8% disallowed Occluded: Model structure: A0A0R1YTE5_occluded.pdb Alignment file: A0A0R1YTE5_occ.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 8.6% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA