Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0R1YTE5

dbSWEET id: dbswt_1990

Accession:   A0A0R1YTE5

Uniprot status:   Unreviewed

Organism:   Lactobacillus parafarraginis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   115

Substrate Binding Site:   ADAD           CVV:   316       CHI:   -3.4

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A0R1YTE5|A0A0R1YTE5_9LACO|Unreviewed|Lactobacillus parafarraginis| 115
MESFDIQFRLNTPQGQLKETASHRLHHTKHAIDEEKVVGDLATIANMIMYVSYISQIIEN
LNGNPTPPIQPLCAAINAALWTWYGWVKPKRDWILIVADVPGVIFGVLTAVTAVI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   39     Model end:   115

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0R1YTE5_inward.pdb    Alignment file: A0A0R1YTE5_inw.pir

Procheck score ⇒ Ramachandran plot: 89.1% favored    9.4% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0R1YTE5_outward.pdb    Alignment file: A0A0R1YTE5_out.pir

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.5% allowed    .8% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0R1YTE5_occluded.pdb    Alignment file: A0A0R1YTE5_occ.pir

Procheck score ⇒ Ramachandran plot: 89.8% favored    8.6% allowed    .8% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur