Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R1Y578
dbSWEET id: dbswt_1482
Accession: A0A0R1Y578
Uniprot status: Unreviewed
Organism: Lactobacillus pontis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 94
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1Y578|A0A0R1Y578_9LACO|Unreviewed|Lactobacillus pontis|94
MDDKEVMKRSHEAKVIGNIATVACLIMYASYIDQIALNFTGHPVSPLQPICAAINASLWV
AYGWLKPDKDWPVIIANFPGIIFGAVTFITSFIH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 17 Model end: 93 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1Y578_inward.pdb Alignment file: A0A0R1Y578_inw.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 7.0% allowed 2.3% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1Y578_outward.pdb Alignment file: A0A0R1Y578_out.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 6.2% allowed .8% week 2.3% disallowed Occluded: Model structure: A0A0R1Y578_occluded.pdb Alignment file: A0A0R1Y578_occ.pir Procheck score ⇒ Ramachandran plot: 92.2% favored 7.8% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA