| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0R1XN41
dbSWEET id: dbswt_1481
Accession: A0A0R1XN41
Uniprot status: Unreviewed
Organism: Lactobacillus intestinalis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 93
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1XN41|A0A0R1XN41_9LACO|Unreviewed|Lactobacillus intestinalis|93
MLKKLKSLDDKTVLTIGRIGSVLSVLMYVSYVPQIMNNLHGQYGNPIQPLVAAINCTIWV
LYAILREKKDWPLFIANFPGIIFGLITFFTSLH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 17 Model end: 93 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1XN41_inward.pdb Alignment file: A0A0R1XN41_inw.pir Procheck score ⇒ Ramachandran plot: 94.5% favored 4.7% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1XN41_outward.pdb Alignment file: A0A0R1XN41_out.pir Procheck score ⇒ Ramachandran plot: 92.2% favored 7.0% allowed .8% week .0% disallowed Occluded: Model structure: A0A0R1XN41_occluded.pdb Alignment file: A0A0R1XN41_occ.pir Procheck score ⇒ Ramachandran plot: 92.2% favored 5.5% allowed 2.3% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA