| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0R1XBV3
dbSWEET id: dbswt_1480
Accession: A0A0R1XBV3
Uniprot status: Unreviewed
Organism: Lactobacillus panis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 95
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1XBV3|A0A0R1XBV3_9LACO|Unreviewed|Lactobacillus panis|95
MNSQKPTVKQRVRKFTGNFATIACLVMYFSYIEQIIANFTGHPVSPVQPFFASINALLWV
IYGWVKPDKKDWPVIIANFPGIIFVLVTAVTSFVH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 17 Model end: 94 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1XBV3_inward.pdb Alignment file: A0A0R1XBV3_inw.pir Procheck score ⇒ Ramachandran plot: 90.9% favored 7.6% allowed .8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1XBV3_outward.pdb Alignment file: A0A0R1XBV3_out.pir Procheck score ⇒ Ramachandran plot: 90.2% favored 5.3% allowed 2.3% week 2.3% disallowed Occluded: Model structure: A0A0R1XBV3_occluded.pdb Alignment file: A0A0R1XBV3_occ.pir Procheck score ⇒ Ramachandran plot: 90.9% favored 6.8% allowed 2.3% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA