| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0R1WIS4
dbSWEET id: dbswt_1479
Accession: A0A0R1WIS4
Uniprot status: Unreviewed
Organism: Lactobacillus nantensis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 98
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1WIS4|A0A0R1WIS4_9LACO|Unreviewed|Lactobacillus nantensis|98
MKGSYYLRKVSSEKVEKIGTVASAMSVLMYVSYIPQIMSNLSGSKGNPIQPLVAFINCTI
WTAYGLLKKEKDWPIVWANIPGIFLGAATFITAIFNFS
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 19 Model end: 95 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1WIS4_inward.pdb Alignment file: A0A0R1WIS4_inw.pir Procheck score ⇒ Ramachandran plot: 84.4% favored 11.7% allowed 2.3% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1WIS4_outward.pdb Alignment file: A0A0R1WIS4_out.pir Procheck score ⇒ Ramachandran plot: 85.2% favored 10.2% allowed 3.9% week .8% disallowed Occluded: Model structure: A0A0R1WIS4_occluded.pdb Alignment file: A0A0R1WIS4_occ.pir Procheck score ⇒ Ramachandran plot: 87.5% favored 10.2% allowed .8% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA