Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R1VS46
dbSWEET id: dbswt_1477
Accession: A0A0R1VS46
Uniprot status: Unreviewed
Organism: Lactobacillus ghanensis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 89
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1VS46|A0A0R1VS46_9LACO|Unreviewed|Lactobacillus ghanensis|89
MKEENKFILIVGRTATILAVLMYVSYIPQIINNLQGDYSNPIQPLVAAINCTFWSIYAYF
KMDRDWLIFWANIPGVFFGLAAFVTALHA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1VS46_inward.pdb Alignment file: A0A0R1VS46_inw.pir Procheck score ⇒ Ramachandran plot: 87.3% favored 11.9% allowed .7% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1VS46_outward.pdb Alignment file: A0A0R1VS46_out.pir Procheck score ⇒ Ramachandran plot: 90.3% favored 7.5% allowed 2.2% week .0% disallowed Occluded: Model structure: A0A0R1VS46_occluded.pdb Alignment file: A0A0R1VS46_occ.pir Procheck score ⇒ Ramachandran plot: 88.1% favored 11.9% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA