Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R1V8J6
dbSWEET id: dbswt_1476
Accession: A0A0R1V8J6
Uniprot status: Unreviewed
Organism: Lactobacillus farraginis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 108
Substrate Binding Site: ASAS CVV: 280 CHI: 2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1V8J6|A0A0R1V8J6_9LACO|Unreviewed|Lactobacillus farraginis| 108
MQRQLRPTQGQFRNQVQDALHKKRVDEIKLIGDFATIANFIMYVSYIGEIIGNLNGDPIS
PVQPLFAALNATLWVGYGWLKPTKDWRLIIASFPGVVFGILTALTAMM
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 32 Model end: 108 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1V8J6_inward.pdb Alignment file: A0A0R1V8J6_inw.pir Procheck score ⇒ Ramachandran plot: 86.3% favored 10.5% allowed .8% week 2.4% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1V8J6_outward.pdb Alignment file: A0A0R1V8J6_out.pir Procheck score ⇒ Ramachandran plot: 89.5% favored 9.7% allowed .0% week .8% disallowed Occluded: Model structure: A0A0R1V8J6_occluded.pdb Alignment file: A0A0R1V8J6_occ.pir Procheck score ⇒ Ramachandran plot: 89.5% favored 10.5% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA