Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R1V6L7
dbSWEET id: dbswt_1475
Accession: A0A0R1V6L7
Uniprot status: Unreviewed
Organism: Lactobacillus satsumensis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1V6L7|A0A0R1V6L7_9LACO|Unreviewed|Lactobacillus satsumensis|88
MKEEDKFIQVLGRVATVLSVLMYVSYIPQIMSNLQGNYGNPIQPLVAAINCLFWCVYAYF
KKNRDWPVFLANLPGIFFGVFAFVTALH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1V6L7_inward.pdb Alignment file: A0A0R1V6L7_inw.pir Procheck score ⇒ Ramachandran plot: 86.2% favored 12.3% allowed .0% week 1.5% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1V6L7_outward.pdb Alignment file: A0A0R1V6L7_out.pir Procheck score ⇒ Ramachandran plot: 93.1% favored 5.4% allowed 1.5% week .0% disallowed Occluded: Model structure: A0A0R1V6L7_occluded.pdb Alignment file: A0A0R1V6L7_occ.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 4.6% allowed 2.3% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA