Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0R1V0X4

dbSWEET id: dbswt_1474

Accession:   A0A0R1V0X4

Uniprot status:   Unreviewed

Organism:   Lactobacillus satsumensis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   79

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   ININ           CVV:   440       CHI:   2

Fasta sequence:

>tr|A0A0R1V0X4|A0A0R1V0X4_9LACO|Unreviewed|Lactobacillus satsumensis|79
MGKTATVACLIMYFSYIEQIIANLTSKPVPSIQPLFAAINAFLWVTYGFLKDKKDLPIII
ANLPGVILGLITFLTSIVK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   78

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0R1V0X4_inward.pdb    Alignment file: A0A0R1V0X4_inw.pir

Procheck score ⇒ Ramachandran plot: 90.2% favored    8.2% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0R1V0X4_outward.pdb    Alignment file: A0A0R1V0X4_out.pir

Procheck score ⇒ Ramachandran plot: 92.6% favored    6.6% allowed    .0% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0R1V0X4_occluded.pdb    Alignment file: A0A0R1V0X4_occ.pir

Procheck score ⇒ Ramachandran plot: 94.3% favored    5.7% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur