| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0R1U6Q6
dbSWEET id: dbswt_1473
Accession: A0A0R1U6Q6
Uniprot status: Unreviewed
Organism: Lactobacillus pantheris
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 104
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1U6Q6|A0A0R1U6Q6_9LACO|Unreviewed|Lactobacillus pantheris| 104
MRIDTSKYPEGKEAVDPKRVKRLKILSKVATIMCISMYISYIPQIIANFSGSPVSPIQPL
VASINACLWVAYGWNKTYKDWPVIISNLPGIVFGLVTVITVYVH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 27 Model end: 103 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1U6Q6_inward.pdb Alignment file: A0A0R1U6Q6_inw.pir Procheck score ⇒ Ramachandran plot: 89.1% favored 8.6% allowed 1.6% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1U6Q6_outward.pdb Alignment file: A0A0R1U6Q6_out.pir Procheck score ⇒ Ramachandran plot: 85.9% favored 7.8% allowed 3.9% week 2.3% disallowed Occluded: Model structure: A0A0R1U6Q6_occluded.pdb Alignment file: A0A0R1U6Q6_occ.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 6.2% allowed .8% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA