| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0R1T045
dbSWEET id: dbswt_1472
Accession: A0A0R1T045
Uniprot status: Unreviewed
Organism: Lactobacillus parakefiri
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 103
Substrate Binding Site: ADAD CVV: 316 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1T045|A0A0R1T045_9LACO|Unreviewed|Lactobacillus parakefiri| 103
MQSQLSHPGGSQLHENKQVFSEEKVIGDIATVANMIMYISYIGEILQNLNGQPTSFIQPF
CAAINAALWVAYGWVKPKRDWILIVADVPGVIFGLIAAITAVI
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 27 Model end: 103 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1T045_inward.pdb Alignment file: A0A0R1T045_inw.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 6.2% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1T045_outward.pdb Alignment file: A0A0R1T045_out.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 8.5% allowed .0% week .8% disallowed Occluded: Model structure: A0A0R1T045_occluded.pdb Alignment file: A0A0R1T045_occ.pir Procheck score ⇒ Ramachandran plot: 90.0% favored 9.2% allowed .0% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA