Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R1P8Q4
dbSWEET id: dbswt_1470
Accession: A0A0R1P8Q4
Uniprot status: Unreviewed
Organism: Lactobacillus frumenti
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 125
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1P8Q4|A0A0R1P8Q4_9LACO|Unreviewed|Lactobacillus frumenti| 125
MMSKEKVISKDELTGKEKKVSPQVVSKQVEPDKEWVAKRLKQVKISGNIATIACLIMYSS
YVEQIIANFSGHPVSPVQPFFAAINATMWVVYGWLKPIKKDWPVIISNFPGIIFGIITAI
TAFIH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 47 Model end: 124 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1P8Q4_inward.pdb Alignment file: A0A0R1P8Q4_inw.pir Procheck score ⇒ Ramachandran plot: 88.5% favored 7.7% allowed 3.1% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1P8Q4_outward.pdb Alignment file: A0A0R1P8Q4_out.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 5.4% allowed 3.8% week .0% disallowed Occluded: Model structure: A0A0R1P8Q4_occluded.pdb Alignment file: A0A0R1P8Q4_occ.pir Procheck score ⇒ Ramachandran plot: 89.2% favored 9.2% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA