| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0R1NNX5
dbSWEET id: dbswt_1468
Accession: A0A0R1NNX5
Uniprot status: Unreviewed
Organism: Lactobacillus kisonensis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 96
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1NNX5|A0A0R1NNX5_9LACO|Unreviewed|Lactobacillus kisonensis|96
MSLMRAKREVNRLEEVKFVGDFATVACLIMYVSYIGQIIANLNGNPVSPMQPLFASLNAA
LWVGYGWLKPHKDWRVIIANFPGIIFGILTALTVIM
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 20 Model end: 96 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1NNX5_inward.pdb Alignment file: A0A0R1NNX5_inw.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 7.1% allowed 3.2% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1NNX5_outward.pdb Alignment file: A0A0R1NNX5_out.pir Procheck score ⇒ Ramachandran plot: 90.5% favored 6.3% allowed 3.2% week .0% disallowed Occluded: Model structure: A0A0R1NNX5_occluded.pdb Alignment file: A0A0R1NNX5_occ.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 7.1% allowed 1.6% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA