Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R1MNJ1
dbSWEET id: dbswt_1466
Accession: A0A0R1MNJ1
Uniprot status: Unreviewed
Organism: Lactobacillus perolens
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 101
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1MNJ1|A0A0R1MNJ1_9LACO|Unreviewed|Lactobacillus perolens| 101
MRYDTGEYPKNVDPKRVKRLKLLSKVATITCISMYVSYIPQIIANFSGNPVSPIQPLVAM
INACLWVAYGWFKTYKDWPVIISNLPGIVFGLVTVVTVYIH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 24 Model end: 100 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1MNJ1_inward.pdb Alignment file: A0A0R1MNJ1_inw.pir Procheck score ⇒ Ramachandran plot: 92.2% favored 7.0% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1MNJ1_outward.pdb Alignment file: A0A0R1MNJ1_out.pir Procheck score ⇒ Ramachandran plot: 86.7% favored 9.4% allowed 1.6% week 2.3% disallowed Occluded: Model structure: A0A0R1MNJ1_occluded.pdb Alignment file: A0A0R1MNJ1_occ.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 1.6% allowed 3.1% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA