Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0R1ME30

dbSWEET id: dbswt_1464

Accession:   A0A0R1ME30

Uniprot status:   Unreviewed

Organism:   Lactobacillus oeni

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A0R1ME30|A0A0R1ME30_9LACO|Unreviewed|Lactobacillus oeni|88
MKEEDKFIQVLGRVATVLSVLMYVSYIPQIMSNLQGDYGNPIQPLVAAINCLFWCIYAYF
KKNRDWPVFLANLPGIFFGIFAFATALH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   12     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0R1ME30_inward.pdb    Alignment file: A0A0R1ME30_inw.pir

Procheck score ⇒ Ramachandran plot: 87.7% favored    11.5% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0R1ME30_outward.pdb    Alignment file: A0A0R1ME30_out.pir

Procheck score ⇒ Ramachandran plot: 83.8% favored    12.3% allowed    2.3% week    1.5% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0R1ME30_occluded.pdb    Alignment file: A0A0R1ME30_occ.pir

Procheck score ⇒ Ramachandran plot: 90.0% favored    6.9% allowed    1.5% week    1.5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur