| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0R1ME30
dbSWEET id: dbswt_1464
Accession: A0A0R1ME30
Uniprot status: Unreviewed
Organism: Lactobacillus oeni
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1ME30|A0A0R1ME30_9LACO|Unreviewed|Lactobacillus oeni|88
MKEEDKFIQVLGRVATVLSVLMYVSYIPQIMSNLQGDYGNPIQPLVAAINCLFWCIYAYF
KKNRDWPVFLANLPGIFFGIFAFATALH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1ME30_inward.pdb Alignment file: A0A0R1ME30_inw.pir Procheck score ⇒ Ramachandran plot: 87.7% favored 11.5% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1ME30_outward.pdb Alignment file: A0A0R1ME30_out.pir Procheck score ⇒ Ramachandran plot: 83.8% favored 12.3% allowed 2.3% week 1.5% disallowed Occluded: Model structure: A0A0R1ME30_occluded.pdb Alignment file: A0A0R1ME30_occ.pir Procheck score ⇒ Ramachandran plot: 90.0% favored 6.9% allowed 1.5% week 1.5% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA