Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R1L1K9
dbSWEET id: dbswt_2014
Accession: A0A0R1L1K9
Uniprot status: Unreviewed
Organism: Lactobacillus curvatus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 104
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1L1K9|A0A0R1L1K9_LACCU|Unreviewed|Lactobacillus curvatus| 104
MKTKDVTIRYQKTATVHSDRNQLAWLGKIAVGTCFLMYVSYIQQIMANLAGHPVSAIQPS
VAMVNATLWFSYGWFKPHKDWPIIISNVPGIIFGLVTLITIYYH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 27 Model end: 103 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1L1K9_inward.pdb Alignment file: A0A0R1L1K9_inw.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 8.6% allowed .0% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1L1K9_outward.pdb Alignment file: A0A0R1L1K9_out.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 7.8% allowed .8% week .8% disallowed Occluded: Model structure: A0A0R1L1K9_occluded.pdb Alignment file: A0A0R1L1K9_occ.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 7.0% allowed .8% week 2.3% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA