Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R1KVL3
dbSWEET id: dbswt_1462
Accession: A0A0R1KVL3
Uniprot status: Unreviewed
Organism: Lactobacillus sunkii
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 103
Substrate Binding Site: ADAD CVV: 316 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1KVL3|A0A0R1KVL3_9LACO|Unreviewed|Lactobacillus sunkii| 103
MQSQLSHPNGSQVHAGKHVYTEEKIIGDIATVANMIMYISYIGEILQNLNGQPTSFIQPF
CASINAALWVAYGWVKPKRDWILIVADVPGVIFGLIAAITAVI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 27 Model end: 103 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1KVL3_inward.pdb Alignment file: A0A0R1KVL3_inw.pir Procheck score ⇒ Ramachandran plot: 89.2% favored 7.7% allowed 2.3% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1KVL3_outward.pdb Alignment file: A0A0R1KVL3_out.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 6.9% allowed .8% week 1.5% disallowed Occluded: Model structure: A0A0R1KVL3_occluded.pdb Alignment file: A0A0R1KVL3_occ.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 6.9% allowed .0% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA