Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R1I147
dbSWEET id: dbswt_1458
Accession: A0A0R1I147
Uniprot status: Unreviewed
Organism: Lactobacillus paralimentarius
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 93
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1I147|A0A0R1I147_9LACO|Unreviewed|Lactobacillus paralimentarius|93
MDQSKVKKVNKDFLFYVSRLATVFSIMMYVSYIPQILDNMSGVKGNPIQPLSAMINSSLW
VLYGLLKEKKDWPVIIANLPGIVLGLLTFLTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 18 Model end: 94 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1I147_inward.pdb Alignment file: A0A0R1I147_inw.pir Procheck score ⇒ Ramachandran plot: 93.0% favored 6.2% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1I147_outward.pdb Alignment file: A0A0R1I147_out.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 6.2% allowed 1.6% week .8% disallowed Occluded: Model structure: A0A0R1I147_occluded.pdb Alignment file: A0A0R1I147_occ.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 7.0% allowed 1.6% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA