Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R1EUH3
dbSWEET id: dbswt_1456
Accession: A0A0R1EUH3
Uniprot status: Unreviewed
Organism: Lactobacillus zeae
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 123
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R1EUH3|A0A0R1EUH3_LACZE|Unreviewed|Lactobacillus zeae| 123
MPSLVFTFDRVTVILFQKEAFLMQADNGKYHSGIDPVKAKRLNLLSRLATFTCILMYVSY
IPEIMANFSGTPVNPIQPLVAMINATLWTGYGWMKPAKDWPIIIANVPGILFGLITFVTV
FVH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 46 Model end: 122 Inward Open: Template: 4X5M.pdb Model structure: A0A0R1EUH3_inward.pdb Alignment file: A0A0R1EUH3_inw.pir Procheck score ⇒ Ramachandran plot: 91.1% favored 5.6% allowed 2.4% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R1EUH3_outward.pdb Alignment file: A0A0R1EUH3_out.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 3.2% allowed 2.4% week .0% disallowed Occluded: Model structure: A0A0R1EUH3_occluded.pdb Alignment file: A0A0R1EUH3_occ.pir Procheck score ⇒ Ramachandran plot: 90.3% favored 8.9% allowed .0% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA