Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0R0ES24

dbSWEET id: dbswt_454

Accession:   A0A0R0ES24

Uniprot status:   Unreviewed

Organism:   Glycine max

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.

Sequence Information back to top


Sequence length:   318

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   LCMN           CVV:   430       CHI:   4.7

Fasta sequence:

>tr|A0A0R0ES24|A0A0R0ES24_SOYBN|Unreviewed|Glycine_max|318
MSGKKSFTTSLDVLNAIIINGIHINFLFIDFTSFFFKMKSKTFCRVVKKKSTENYKGAPY
ITTFLCTSLWTSYGVLKPGGFQIAIVNGAGAVFHCTYIILFLVYSPQDQKVKTALWVAIL
DVGFLGTVISVTLFALHGTIQLSVLGMFCSGLTIIMYASPLLSMKMVIQTKSVEYMPFLL
SFFMFLNAGVWALYSFLVKDFFIGIPNLIGLILGSTQLTVYVVYKKKQPEATKGPRVGLS
LGKGASNYEEAQLKDETVKVVVVEKALKKVKSLPKPVLNHEHILKKTLSFGVNNLPSTFW
STKPQQEDVAVDAEEAQV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   6     Model end:   226

Alignment file: A0A0R0ES24.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0R0ES24_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    4.1% allowed    2.0% week    3.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0R0ES24_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.3% favored    7.7% allowed    1.0% week    1.0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0R0ES24_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    6.1% allowed    1.0% week    1.0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur