Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0Q8QFD7

dbSWEET id: dbswt_1453

Accession:   A0A0Q8QFD7

Uniprot status:   Unreviewed

Organism:   Noviherbaspirillum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Burkholderiales ⇒ Oxalobacteraceae ⇒ Noviherbaspirillum.

Sequence Information back to top


Sequence length:   105

Substrate Binding Site:   SNSN           CVV:   338       CHI:   -8.6

Selectivity Filter:   TATA           CVV:   320       CHI:   2.2

Fasta sequence:

>tr|A0A0Q8QFD7|A0A0Q8QFD7_9BURK|Unreviewed|Noviherbaspirillum| 105
MNADIVGWISSLVLVSTISRQVYTQWRTKRVDGVSKWLFIGQLSASFGFTIYSYLVDNWV
FVFTNFFMFLTAVVGEFIYLSNKRHAQRQATTQENPSGTAHAAGR

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   81

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0Q8QFD7_inward.pdb    Alignment file: A0A0Q8QFD7_inw.pir

Procheck score ⇒ Ramachandran plot: 95.0% favored    4.3% allowed    .0% week    .7% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0Q8QFD7_outward.pdb    Alignment file: A0A0Q8QFD7_out.pir

Procheck score ⇒ Ramachandran plot: 92.9% favored    6.4% allowed    .0% week    .7% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0Q8QFD7_occluded.pdb    Alignment file: A0A0Q8QFD7_occ.pir

Procheck score ⇒ Ramachandran plot: 93.6% favored    5.7% allowed    .7% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur