Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0Q6YZ08

dbSWEET id: dbswt_1450

Accession:   A0A0Q6YZ08

Uniprot status:   Unreviewed

Organism:   Afipia

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rhizobiales ⇒ Bradyrhizobiaceae ⇒ Afipia.

Sequence Information back to top


Sequence length:   89

Substrate Binding Site:   ININ           CVV:   440       CHI:   2

Selectivity Filter:   CGCG           CVV:   268       CHI:   4.2

Fasta sequence:

>tr|A0A0Q6YZ08|A0A0Q6YZ08_9BRAD|Unreviewed|Afipia|89
MTESVPAVVHWVGALAAVLTTLCWLPQVVRVIRLKDTHAISLATNLVFAGGILLWLIYGI
AIGNWPLIAANAVSMVLTLIIIAMKLRYG

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0Q6YZ08_inward.pdb    Alignment file: A0A0Q6YZ08_inw.pir

Procheck score ⇒ Ramachandran plot: 96.3% favored    2.2% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0Q6YZ08_outward.pdb    Alignment file: A0A0Q6YZ08_out.pir

Procheck score ⇒ Ramachandran plot: 91.9% favored    7.4% allowed    .0% week    .7% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0Q6YZ08_occluded.pdb    Alignment file: A0A0Q6YZ08_occ.pir

Procheck score ⇒ Ramachandran plot: 97.1% favored    2.9% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur