| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0Q6YZ08
dbSWEET id: dbswt_1450
Accession: A0A0Q6YZ08
Uniprot status: Unreviewed
Organism: Afipia
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rhizobiales ⇒ Bradyrhizobiaceae ⇒ Afipia.
Sequence Information back to top
Sequence length: 89
Substrate Binding Site: ININ CVV: 440 CHI: 2
Selectivity Filter: CGCG CVV: 268 CHI: 4.2
Fasta sequence:
>tr|A0A0Q6YZ08|A0A0Q6YZ08_9BRAD|Unreviewed|Afipia|89
MTESVPAVVHWVGALAAVLTTLCWLPQVVRVIRLKDTHAISLATNLVFAGGILLWLIYGI
AIGNWPLIAANAVSMVLTLIIIAMKLRYG
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: A0A0Q6YZ08_inward.pdb Alignment file: A0A0Q6YZ08_inw.pir Procheck score ⇒ Ramachandran plot: 96.3% favored 2.2% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0Q6YZ08_outward.pdb Alignment file: A0A0Q6YZ08_out.pir Procheck score ⇒ Ramachandran plot: 91.9% favored 7.4% allowed .0% week .7% disallowed Occluded: Model structure: A0A0Q6YZ08_occluded.pdb Alignment file: A0A0Q6YZ08_occ.pir Procheck score ⇒ Ramachandran plot: 97.1% favored 2.9% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA