| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0Q4K4T2
dbSWEET id: dbswt_1442
Accession: A0A0Q4K4T2
Uniprot status: Unreviewed
Organism: Sphingomonas
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Sphingomonadales ⇒ Sphingomonadaceae ⇒ Sphingomonas.
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0Q4K4T2|A0A0Q4K4T2_9SPHN|Unreviewed|Sphingomonas|85
MSERGILVLGWIATATAIVMYLSYIDQIMLNLAGQKGSVVQPFATMVNCGLWVAYGVLKP
KRDWPIAVANFPGVVLGAITLATAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: A0A0Q4K4T2_inward.pdb Alignment file: A0A0Q4K4T2_inw.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 5.5% allowed .0% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0Q4K4T2_outward.pdb Alignment file: A0A0Q4K4T2_out.pir Procheck score ⇒ Ramachandran plot: 92.2% favored 5.5% allowed 1.6% week .8% disallowed Occluded: Model structure: A0A0Q4K4T2_occluded.pdb Alignment file: A0A0Q4K4T2_occ.pir Procheck score ⇒ Ramachandran plot: 92.2% favored 7.8% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA