| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0Q4CCG6
dbSWEET id: dbswt_1437
Accession: A0A0Q4CCG6
Uniprot status: Unreviewed
Organism: Chryseobacterium
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Chryseobacterium.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0Q4CCG6|A0A0Q4CCG6_9FLAO|Unreviewed|Chryseobacterium|87
MDNEKFFKVLGWVATITAVAMYVSYIPQIRSNLAGNKGEWLQPLVAAVNCTLWVVYGFMK
KPERDLPIIMANSPGIVFGLFAFFTAI
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: A0A0Q4CCG6_inward.pdb Alignment file: A0A0Q4CCG6_inw.pir Procheck score ⇒ Ramachandran plot: 93.1% favored 4.6% allowed 2.3% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0Q4CCG6_outward.pdb Alignment file: A0A0Q4CCG6_out.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 5.4% allowed .8% week .0% disallowed Occluded: Model structure: A0A0Q4CCG6_occluded.pdb Alignment file: A0A0Q4CCG6_occ.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 4.6% allowed 1.5% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA