Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0P8YS58

dbSWEET id: dbswt_2053

Accession:   A0A0P8YS58

Uniprot status:   Unreviewed

Organism:   Nitrosopumilus

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Thaumarchaeota ⇒ Nitrosopumilales ⇒ Nitrosopumilaceae;Nitrosopumilus.

Sequence Information back to top


Sequence length:   94

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   GGGG           CVV:   192       CHI:   -1.6

Fasta sequence:

>tr|A0A0P8YS58|A0A0P8YS58_9ARCH|Unreviewed|Nitrosopumilus|94
MEIDGILLTLLGTAAGVLILTGWVEQIYKGYKTKSLKDISKFLMIFISAGAILWLIYGIV
VSDVYIIGTNIAAIILMMIVLTMKKKYDKLSKIN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   9     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0P8YS58_inward.pdb    Alignment file: A0A0P8YS58_inw.pir

Procheck score ⇒ Ramachandran plot: 94.1% favored    5.1% allowed    .7% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0P8YS58_outward.pdb    Alignment file: A0A0P8YS58_out.pir

Procheck score ⇒ Ramachandran plot: 94.9% favored    4.4% allowed    .7% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0P8YS58_occluded.pdb    Alignment file: A0A0P8YS58_occ.pir

Procheck score ⇒ Ramachandran plot: 94.9% favored    4.4% allowed    .7% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur