Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0P5X4P1

dbSWEET id: dbswt_1074

Accession:   A0A0P5X4P1

Uniprot status:   Unreviewed

Organism:   Daphnia magna

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Crustacea ⇒ Branchiopoda ⇒ Diplostraca ⇒ Cladocera ⇒ Anomopoda ⇒ Daphniidae ⇒ Daphnia.

Sequence Information back to top


Sequence length:   219

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   QGFV           CVV:   402       CHI:   3.1

Fasta sequence:

>tr|A0A0P5X4P1|A0A0P5X4P1_9CRUS|Unreviewed|Daphnia_magna|219
MALENFREILSVTATVTTIIQFLTGVIICASIRKKGISGEISGFPFIAGVLGCSLWLRYG
MLMKDSAMITVNAVGLVLQMSYVCMYYVYATHKEAYLKQVLIVLSVVLTTMFYVVVETNE
DKAEFRLGLLCCATTLIFCSAPLATLGDVLRTRSTETLPFYLILANVLVAAQWFLYGVAV
HNTFVQVPNFISCLIALFQLALFAVFPSTSTRTKLQNVV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   208

Alignment file: A0A0P5X4P1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0P5X4P1_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.0% favored    6.8% allowed    2.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0P5X4P1_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.1% favored    6.8% allowed    2.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0P5X4P1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.5% favored    6.3% allowed    1.6% week    1.6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur