Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0P5X4P1
dbSWEET id: dbswt_1074
Accession: A0A0P5X4P1
Uniprot status: Unreviewed
Organism: Daphnia magna
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Crustacea ⇒ Branchiopoda ⇒ Diplostraca ⇒ Cladocera ⇒ Anomopoda ⇒ Daphniidae ⇒ Daphnia.
Sequence Information back to top
Sequence length: 219
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: QGFV CVV: 402 CHI: 3.1
Fasta sequence:
>tr|A0A0P5X4P1|A0A0P5X4P1_9CRUS|Unreviewed|Daphnia_magna|219
MALENFREILSVTATVTTIIQFLTGVIICASIRKKGISGEISGFPFIAGVLGCSLWLRYG
MLMKDSAMITVNAVGLVLQMSYVCMYYVYATHKEAYLKQVLIVLSVVLTTMFYVVVETNE
DKAEFRLGLLCCATTLIFCSAPLATLGDVLRTRSTETLPFYLILANVLVAAQWFLYGVAV
HNTFVQVPNFISCLIALFQLALFAVFPSTSTRTKLQNVV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 208
Alignment file: A0A0P5X4P1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0P5X4P1_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.0% favored 6.8% allowed 2.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0P5X4P1_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.1% favored 6.8% allowed 2.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0P5X4P1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.5% favored 6.3% allowed 1.6% week 1.6% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA