Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0P4VUR3

dbSWEET id: dbswt_1073

Accession:   A0A0P4VUR3

Uniprot status:   Unreviewed

Organism:   Scylla olivacea

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Crustacea ⇒ Malacostraca ⇒ Eumalacostraca ⇒ Eucarida ⇒ Decapoda ⇒ Pleocyemata ⇒ Brachyura ⇒ Eubrachyura ⇒ Portunoidea ⇒ Portunidae ⇒ Scylla.

Sequence Information back to top


Sequence length:   238

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   QSFV           CVV:   427       CHI:   2.7

Fasta sequence:

>tr|A0A0P4VUR3|A0A0P4VUR3_9EUCA|Unreviewed|Scylla_olivacea|238
MGLNSVLHFLDLKMALQDYKDIIATVATIVTIIQFLSGIDICRKIIKQGSTGDISGFPFV
GGVFSTSTWLTYSLLLWDASMSITNAVGLTLQVIYLCTYVRYCIASGPWRTVRRQMLITT
LVVAAIQYYVFLSDDENETIKTRIGLMCCLGSIIFCASPLVSLAEVFRTRSTDMLPFPLI
FATFLVSGLWWLYGIIIQNSFVKYPNLIGFGLSGFQLFLFIVYPNKRKDNVTGESRAV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   13     Model end:   225

Alignment file: A0A0P4VUR3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0P4VUR3_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.0% favored    6.9% allowed    .5% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0P4VUR3_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    5.3% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0P4VUR3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.9% favored    7.4% allowed    2.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur