| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0P0WJA2
dbSWEET id: dbswt_538
Accession: A0A0P0WJA2
Uniprot status: Unreviewed
Organism: Oryza sativa
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.
Sequence Information back to top
Sequence length: 260
Substrate Binding Site: CSWN CVV: 418 CHI: -2.7
Selectivity Filter: FSMT CVV: 425 CHI: 3.2
Fasta sequence:
>tr|A0A0P0WJA2|A0A0P0WJA2_ORYSJ|Unreviewed|Oryza_sativa|260
MLLYSAPMYPTTCLYIISYTMFAQYIMHCLTLVFTMFPRLTFKRVIKKASVEEFSCIPYI
LALFSCLTYSWYGFPVVSYGWENMTVCSISSLGVLFEGTFISIYVWFAPRGKKKQVMLMA
SLILAVFCMTVFFSSFSIHNHHIRKVFVGSVGLVSSISMYGSPLVAMKQVIRTKSVEFMP
FYLSLFTLFTSLTWMAYGVIGRDPFIATPNCIGSIMGILQLVVYCIYSKCKEAPKVLHDI
EQANVVKIPTSHVDTKGHNP
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 13 Model end: 229
Alignment file: A0A0P0WJA2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0P0WJA2_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.3% favored 3.6% allowed 1.0% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0P0WJA2_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.8% favored 6.7% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0P0WJA2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.7% favored 8.8% allowed 1.0% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA