| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0N8EUD9
dbSWEET id: dbswt_1072
Accession: A0A0N8EUD9
Uniprot status: Unreviewed
Organism: Heterocephalus glaber
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Euarchontoglires ⇒ Glires ⇒ Rodentia ⇒ Hystricognathi ⇒ Bathyergidae ⇒ Heterocephalus.
Sequence Information back to top
Sequence length: 221
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMS CVV: 417 CHI: -0.5
Fasta sequence:
>tr|A0A0N8EUD9|A0A0N8EUD9_HETGA|Unreviewed|Heterocephalus_glaber|221
METGSVADSLLSGACVFFTLGMFSTGLSDLRHMQMTRSVDSVQFLPFLTTDVNNLGWLSY
GVLKGDGTLIIVNTVGAVLQTLYIAAYLRYCPQKRMVLLQTATLLGVLFLGYGYFGVLMP
NDEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTHRLSFSLTIATLLSSASWSLYGF
RLSDPYITVPNLPGILTSFIRLWLFWKYPPEQDKNYWLLHT
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: A0A0N8EUD9.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0N8EUD9_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.8% favored 7.1% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0N8EUD9_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.8% favored 8.2% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0N8EUD9_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.3% favored 7.6% allowed .5% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA