Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0N7HC57

dbSWEET id: dbswt_2052

Accession:   A0A0N7HC57

Uniprot status:   Unreviewed

Organism:   Candidatus Nitrocosmicus

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Thaumarchaeota ⇒ Nitrososphaeria ⇒ Nitrososphaerales;Nitrososphaeraceae ⇒ Candidatus Nitrosocosmicus.

Sequence Information back to top


Sequence length:   100

Substrate Binding Site:   LNLN           CVV:   440       CHI:   0.6

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|A0A0N7HC57|A0A0N7HC57_9ARCH|Unreviewed|Candidatus Nitrocosmicus|100
MLNIAGWMVDTLLTLIGLLATAFSVASTLPQIRKALKTRDTEDVSIRFLAVLIVGLFLWA
IYGLGRADNVIIIGNTIGLILNICMLALKIMYSRKPLEEG

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   14     Model end:   91

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0N7HC57_inward.pdb    Alignment file: A0A0N7HC57_inw.pir

Procheck score ⇒ Ramachandran plot: 94.1% favored    4.4% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0N7HC57_outward.pdb    Alignment file: A0A0N7HC57_out.pir

Procheck score ⇒ Ramachandran plot: 91.2% favored    8.8% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0N7HC57_occluded.pdb    Alignment file: A0A0N7HC57_occ.pir

Procheck score ⇒ Ramachandran plot: 94.1% favored    5.9% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur