Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0N5DI72

dbSWEET id: dbswt_1070

Accession:   A0A0N5DI72

Uniprot status:   Unreviewed

Organism:   Trichuris muris

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Enoplea ⇒ Dorylaimia ⇒ Trichocephalida ⇒ Trichuridae ⇒ Trichuris.

Sequence Information back to top


Sequence length:   210

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   MSNV           CVV:   398       CHI:   1.8

Fasta sequence:

>tr|A0A0N5DI72|A0A0N5DI72_TRIMR|Unreviewed|Trichuris_muris|210
MLLNMLSVVATLSTVSMFLIGIPICAGVVRRRTSEGISIAPYAMCVVSCFFWLQYGILKR
DRIVILINLIGFCLEVVYFFVLYMYSRRKSSLHALAGAMTAICACLVYYLRLNARYDSTL
DRLGTMCLILNVLNFASPLAVLREVMETKSTELLPKPIIIVNLLVSAQWYLYGHLVGDPY
MKIPNMIGACLALLQLSLFLMYPSEREHRG

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   204

Alignment file: A0A0N5DI72.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0N5DI72_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.2% favored    8.7% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0N5DI72_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.2% favored    8.2% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0N5DI72_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.3% favored    6.5% allowed    2.2% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur