Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0N5AMC2

dbSWEET id: dbswt_1066

Accession:   A0A0N5AMC2

Uniprot status:   Unreviewed

Organism:   Syphacia muris

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Oxyurida ⇒ Oxyuroidea ⇒ Oxyuridae ⇒ Syphacia.

Sequence Information back to top


Sequence length:   260

Substrate Binding Site:   SQAP           CVV:   371       CHI:   -1.9

Selectivity Filter:   LCSM           CVV:   407       CHI:   7.4

Fasta sequence:

>tr|A0A0N5AMC2|A0A0N5AMC2_9BILA|Unreviewed|Syphacia_muris|260
MPSTYTDSIANEDDFNILKQLFGSDLSIGGLFNYYYGLYTSNILWSLFLTSTALHAIVLV
ASPLQAVLKWHRRKSSDSDTAIPYLCTTICSTLWLRYSIFIEDVKLVLLQLYALAMQAFI
LLNMFIYRTRKMHFLKSLAPVLSILLFLLIYTEKLSNDQGRILMGRLASTAQICGSLVCP
FLVMKAIQRKAVDFIPFLPVMFTWVMEIHAVIYSVHIHDFYMLVSPSLSLSIFALKFVCS
SSTSNALKNKFSRTFKILSK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   38     Model end:   245

Alignment file: A0A0N5AMC2.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0N5AMC2_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    7.2% allowed    1.5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0N5AMC2_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.3% favored    7.7% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0N5AMC2_occluded.pdb

Procheck score ⇒ Ramachandran plot: 87.7% favored    10.3% allowed    1.0% week    1.0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur