| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0N5AFT7
dbSWEET id: dbswt_1065
Accession: A0A0N5AFT7
Uniprot status: Unreviewed
Organism: Syphacia muris
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Oxyurida ⇒ Oxyuroidea ⇒ Oxyuridae ⇒ Syphacia.
Sequence Information back to top
Sequence length: 240
Substrate Binding Site: GNWN CVV: 403 CHI: -8.3
Selectivity Filter: LSTV CVV: 395 CHI: 6.5
Fasta sequence:
>tr|A0A0N5AFT7|A0A0N5AFT7_9BILA|Unreviewed|Syphacia_muris|240
MFYGGNPSMYDRLLDVFVNVAVFSTICLFLTGFEICWRIKKQNSSTGISSAPFHMGVISG
SLWLQYGLLKGDSNITTVNIVSSFLYSLYIGYYWTKTSYPAKKTQTRIIIIEITFLLCVV
FYVHKTYMDTKTILQCLGIMCMVFNIGTISAPLISLNEVIRSRSTESLPLPLCIANFLVT
LQWLVYGILASDVFILIPNAIALFTSLCQILLFFLYPRRRKLSSSESVNENIEESFLLLS
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 7 Model end: 218
Alignment file: A0A0N5AFT7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0N5AFT7_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.6% favored 8.3% allowed 2.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0N5AFT7_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.2% favored 7.8% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0N5AFT7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.2% favored 6.7% allowed 1.0% week 1.0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA