| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0N4ZRX8
dbSWEET id: dbswt_1064
Accession: A0A0N4ZRX8
Uniprot status: Unreviewed
Organism: Parastrongyloides trichosuri
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Panagrolaimoidea ⇒ Strongyloididae ⇒ Parastrongyloides.
Sequence Information back to top
Sequence length: 234
Substrate Binding Site: SQAN CVV: 309 CHI: -3.3
Selectivity Filter: LGGM CVV: 344 CHI: 4.9
Fasta sequence:
>tr|A0A0N4ZRX8|A0A0N4ZRX8_PARTI|Unreviewed|Parastrongyloides_trichosuri|234
MNSLDNVSFSSSKLIELFTENIIWSLFLTSTAIHAILLITSPIQAVFKWFRRRSSDSDTC
IPYIAGVVGSSLWLRYAIFISDFKMVLLQSYAVFMQSLFIISLLTFRSKKKKLLRSVFAV
YTVIIFYNYYASIIPHEDGKVLTGRLASAAQIAGSLICPYLIYQAISTKVIDFIPMAPVA
FTWVMEAHAIIYSIGIDDFYMLLANTIFFCMDGSLLCMFFIFPTEKTVQKQISM
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 17 Model end: 224
Alignment file: A0A0N4ZRX8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0N4ZRX8_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.5% favored 8.9% allowed 2.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0N4ZRX8_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.1% favored 8.3% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0N4ZRX8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.7% favored 7.3% allowed 1.0% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA