| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0N4ZCF2
dbSWEET id: dbswt_1063
Accession: A0A0N4ZCF2
Uniprot status: Unreviewed
Organism: Parastrongyloides trichosuri
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Panagrolaimoidea ⇒ Strongyloididae ⇒ Parastrongyloides.
Sequence Information back to top
Sequence length: 223
Substrate Binding Site: NLFQ CVV: 469 CHI: -0.4
Selectivity Filter: LIRI CVV: 520 CHI: 8.3
Fasta sequence:
>tr|A0A0N4ZCF2|A0A0N4ZCF2_PARTI|Unreviewed|Parastrongyloides_trichosuri|223
MNFTDAFGVYVGILGISLCLLPLISVKQWVKKNSSDGFPSAGYHTGTFINAIWLKFGLMS
QIDNQNTFLSIMLVLNAIYSFIYFYYSSNKKRFIIETILTIFLIYGILTYTDSLEIEDGV
KCIGRVASFSNSLRFVPAFADIYNVIKIKTTENVPFQQTVAFAFILSQFLTHSLLTGNYY
RMYTQIAGLSTIAIYFVLYIVYPPQTWKVPILGVGAKESKKDN
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 204
Alignment file: A0A0N4ZCF2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0N4ZCF2_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.9% favored 7.0% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0N4ZCF2_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 4.9% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0N4ZCF2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 4.9% allowed .5% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA