Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0N4VFB7

dbSWEET id: dbswt_1061

Accession:   A0A0N4VFB7

Uniprot status:   Unreviewed

Organism:   Enterobius vermicularis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Oxyurida ⇒ Oxyuroidea ⇒ Oxyuridae ⇒ Enterobius.

Sequence Information back to top


Sequence length:   220

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   FMSL           CVV:   456       CHI:   7.7

Fasta sequence:

>tr|A0A0N4VFB7|A0A0N4VFB7_ENTVE|Unreviewed|Enterobius_vermicularis|220
MWLSIFSVWLVGFSMSFTLLPIFQVIDWKKRGSADGFSSINLVLPCLMTSCWLKHGYMTN
DKLNMFINAFNILFFTGYILSFAYFQPKRKYLYGQLASLFISLFAIFRYVDSQPALTAAD
TMGSIAAAMQICSLGGQLYEIKRAISFKHTEYIPAELQFGIFVLVIQWTIYGVVVQNYYI
AVANMAALLVNVITLSLYIIYPPLTWRVPIFGTGPQKKKE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   203

Alignment file: A0A0N4VFB7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0N4VFB7_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.2% favored    6.5% allowed    2.2% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0N4VFB7_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    7.6% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0N4VFB7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 87.5% favored    11.4% allowed    .5% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur