Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0N4VFB7
dbSWEET id: dbswt_1061
Accession: A0A0N4VFB7
Uniprot status: Unreviewed
Organism: Enterobius vermicularis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Oxyurida ⇒ Oxyuroidea ⇒ Oxyuridae ⇒ Enterobius.
Sequence Information back to top
Sequence length: 220
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: FMSL CVV: 456 CHI: 7.7
Fasta sequence:
>tr|A0A0N4VFB7|A0A0N4VFB7_ENTVE|Unreviewed|Enterobius_vermicularis|220
MWLSIFSVWLVGFSMSFTLLPIFQVIDWKKRGSADGFSSINLVLPCLMTSCWLKHGYMTN
DKLNMFINAFNILFFTGYILSFAYFQPKRKYLYGQLASLFISLFAIFRYVDSQPALTAAD
TMGSIAAAMQICSLGGQLYEIKRAISFKHTEYIPAELQFGIFVLVIQWTIYGVVVQNYYI
AVANMAALLVNVITLSLYIIYPPLTWRVPIFGTGPQKKKE
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 203
Alignment file: A0A0N4VFB7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0N4VFB7_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.2% favored 6.5% allowed 2.2% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0N4VFB7_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.8% favored 7.6% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0N4VFB7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 87.5% favored 11.4% allowed .5% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA