Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0N4UYJ5

dbSWEET id: dbswt_1271

Accession:   A0A0N4UYJ5

Uniprot status:   Unreviewed

Organism:   Enterobius vermicularis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Oxyurida ⇒ Oxyuroidea ⇒ Oxyuridae ⇒ Enterobius.

Sequence Information back to top


Sequence length:   251

Substrate Binding Site:   GNWN           CVV:   425       CHI:   -8

Selectivity Filter:   LSTV           CVV:   395       CHI:   6.5

Fasta sequence:

>tr|A0A0N4UYJ5|A0A0N4UYJ5_ENTVE|Unreviewed|Enterobius_vermicularis|251
MIVLNAILQSNQFLYILSNVAVASTICLFLTGVEICWRISKQNSTDGVSSAPFHMGVISG
NLWLQYGLLKGDQTKSEAHLLFKSITANDAENLQAVVKVNVVSSLLYSCYVLYYWMKTKY
PAKKTQDRIVLAEGGFLLAITLFLHQHRVDTNRALNFLGALCVTFNIATVAAPLAALHDV
IKIRSTENLPLPMCIANLLVTSEWFLYGIMVNDFFIKLPNAVALVISIGQILPFFLYPRK
RKSSFSDVEKL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   239

Alignment file: A0A0N4UYJ5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0N4UYJ5_inward.pdb

Procheck score ⇒ Ramachandran plot: 79.7% favored    15.6% allowed    .5% week    4.2% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0N4UYJ5_outward.pdb

Procheck score ⇒ Ramachandran plot: 87.3% favored    9.4% allowed    2.4% week    .9% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0N4UYJ5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.1% favored    8.5% allowed    1.4% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur