Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0N4U673

dbSWEET id: dbswt_1059

Accession:   A0A0N4U673

Uniprot status:   Unreviewed

Organism:   Dracunculus medinensis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Spirurida ⇒ Dracunculoidea ⇒ Dracunculidae ⇒ Dracunculus.

Sequence Information back to top


Sequence length:   240

Substrate Binding Site:   SQAN           CVV:   350       CHI:   -6

Selectivity Filter:   LGSM           CVV:   369       CHI:   4.5

Fasta sequence:

>tr|A0A0N4U673|A0A0N4U673_DRAME|Unreviewed|Dracunculus_medinensis|240
MPVNVDEITAAELLQLFFDFYTDNLIWSLFLTSTAVHAVVLIASPLQAVFKWYRRRSSDS
DTPLPYICAAIGSGLWLRYSIFIEDTKLILLQTYAVIMQIFFLLTLLFYRSKKQQLVKAL
LYILLLQMALYLYIEKLTVDDGRVMTGRFASAAQIAGSFVCPFMIYRAVKTKVIDFIPSA
LVIFTCIMELHAIVYSFAIDDFYMLIANTTFCIMDGSLLCMFFIYPTERKNYRKIQEYLL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   20     Model end:   227

Alignment file: A0A0N4U673.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0N4U673_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.7% favored    7.2% allowed    1.0% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0N4U673_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    6.7% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0N4U673_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    5.2% allowed    3.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur