| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0N1S5D4
dbSWEET id: dbswt_1430
Accession: A0A0N1S5D4
Uniprot status: Unreviewed
Organism: Leuconostoc mesenteroides
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Leuconostoc.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CPCP CVV: 352 CHI: 1.8
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|A0A0N1S5D4|A0A0N1S5D4_LEUME|Unreviewed|Leuconostoc mesenteroides|86
MKNRIHNFVGSIGALIGTMVFIAYIPQIIANLSGDKGQPWQPIVAAFSCLLWVVYGLTND
PKRDYILIIPNTAGVVLGTLTFITSF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: A0A0N1S5D4_inward.pdb Alignment file: A0A0N1S5D4_inw.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 2.4% allowed 1.6% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0N1S5D4_outward.pdb Alignment file: A0A0N1S5D4_out.pir Procheck score ⇒ Ramachandran plot: 91.9% favored 6.5% allowed .8% week .8% disallowed Occluded: Model structure: A0A0N1S5D4_occluded.pdb Alignment file: A0A0N1S5D4_occ.pir Procheck score ⇒ Ramachandran plot: 90.3% favored 7.3% allowed 2.4% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA