Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0N1S484
dbSWEET id: dbswt_1429
Accession: A0A0N1S484
Uniprot status: Unreviewed
Organism: Leuconostoc mesenteroides
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Leuconostoc.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0N1S484|A0A0N1S484_LEUME|Unreviewed|Leuconostoc mesenteroides|86
MKETNFIKYLSWIATVMAVLMYVSYIPQIADNLAGSKANPLQPLVAAINCTLWVIYALKK
NHRDIPVALANFPGIIFGLIAFLTAV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: A0A0N1S484_inward.pdb Alignment file: A0A0N1S484_inw.pir Procheck score ⇒ Ramachandran plot: 89.4% favored 8.3% allowed 1.5% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0N1S484_outward.pdb Alignment file: A0A0N1S484_out.pir Procheck score ⇒ Ramachandran plot: 94.7% favored 4.5% allowed .8% week .0% disallowed Occluded: Model structure: A0A0N1S484_occluded.pdb Alignment file: A0A0N1S484_occ.pir Procheck score ⇒ Ramachandran plot: 90.9% favored 6.8% allowed 1.5% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA