Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0N1KIP8

dbSWEET id: dbswt_1428

Accession:   A0A0N1KIP8

Uniprot status:   Unreviewed

Organism:   Moellerella wisconsensis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Enterobacterales ⇒ Morganellaceae ⇒ Moellerella.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A0N1KIP8|A0A0N1KIP8_9GAMM|Unreviewed|Moellerella wisconsensis|87
MSSTNAPKYVSYIGWIATFTAFCMYVSYIPQIMDNLDGNKTNPLQPAAAAINCTLWVWYG
LKVKDLPVAVANAPGVIFGIIACLTAF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   14     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0N1KIP8_inward.pdb    Alignment file: A0A0N1KIP8_inw.pir

Procheck score ⇒ Ramachandran plot: 92.9% favored    3.2% allowed    2.4% week    1.6% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0N1KIP8_outward.pdb    Alignment file: A0A0N1KIP8_out.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    5.6% allowed    1.6% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0N1KIP8_occluded.pdb    Alignment file: A0A0N1KIP8_occ.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    7.1% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur