Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0M3RI77

dbSWEET id: dbswt_1419

Accession:   A0A0M3RI77

Uniprot status:   Unreviewed

Organism:   Capnocytophaga

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Capnocytophaga.

Sequence Information back to top


Sequence length:   92

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|A0A0M3RI77|A0A0M3RI77_9FLAO|Unreviewed|Capnocytophaga|92
MKEKRNTKQKINLFIGSIGAFIGVAVFVAYIPQIMANLEGHKAQPWQPLFAAGSCLIWVV
YGWTKEPKPDYILIIPNLVGVVLGFLTFITSL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   16     Model end:   93

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0M3RI77_inward.pdb    Alignment file: A0A0M3RI77_inw.pir

Procheck score ⇒ Ramachandran plot: 86.3% favored    8.9% allowed    1.6% week    3.2% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0M3RI77_outward.pdb    Alignment file: A0A0M3RI77_out.pir

Procheck score ⇒ Ramachandran plot: 89.5% favored    8.9% allowed    .8% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0M3RI77_occluded.pdb    Alignment file: A0A0M3RI77_occ.pir

Procheck score ⇒ Ramachandran plot: 86.3% favored    8.9% allowed    4.8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur