| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0M3RI77
dbSWEET id: dbswt_1419
Accession: A0A0M3RI77
Uniprot status: Unreviewed
Organism: Capnocytophaga
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Capnocytophaga.
Sequence Information back to top
Sequence length: 92
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|A0A0M3RI77|A0A0M3RI77_9FLAO|Unreviewed|Capnocytophaga|92
MKEKRNTKQKINLFIGSIGAFIGVAVFVAYIPQIMANLEGHKAQPWQPLFAAGSCLIWVV
YGWTKEPKPDYILIIPNLVGVVLGFLTFITSL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 16 Model end: 93 Inward Open: Template: 4X5M.pdb Model structure: A0A0M3RI77_inward.pdb Alignment file: A0A0M3RI77_inw.pir Procheck score ⇒ Ramachandran plot: 86.3% favored 8.9% allowed 1.6% week 3.2% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0M3RI77_outward.pdb Alignment file: A0A0M3RI77_out.pir Procheck score ⇒ Ramachandran plot: 89.5% favored 8.9% allowed .8% week .8% disallowed Occluded: Model structure: A0A0M3RI77_occluded.pdb Alignment file: A0A0M3RI77_occ.pir Procheck score ⇒ Ramachandran plot: 86.3% favored 8.9% allowed 4.8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA