Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0M3CCQ8

dbSWEET id: dbswt_1418

Accession:   A0A0M3CCQ8

Uniprot status:   Unreviewed

Organism:   Sphingobacterium

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Sphingobacteriia ⇒ Sphingobacteriales ⇒ Sphingobacteriaceae ⇒ Sphingobacterium.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   LNLN           CVV:   440       CHI:   0.6

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|A0A0M3CCQ8|A0A0M3CCQ8_9SPHI|Unreviewed|Sphingobacterium|86
MILENIIGITAGILTSISMLPQLLKVIKEKTVEDLSLPMIIILITGLSLWVWYGIIKNEL
PIIISNAFAVLVNLFLLSYYLRFKDK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0M3CCQ8_inward.pdb    Alignment file: A0A0M3CCQ8_inw.pir

Procheck score ⇒ Ramachandran plot: 94.1% favored    5.1% allowed    .7% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0M3CCQ8_outward.pdb    Alignment file: A0A0M3CCQ8_out.pir

Procheck score ⇒ Ramachandran plot: 91.9% favored    7.4% allowed    .7% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0M3CCQ8_occluded.pdb    Alignment file: A0A0M3CCQ8_occ.pir

Procheck score ⇒ Ramachandran plot: 93.4% favored    6.6% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur