| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0M3CCQ8
dbSWEET id: dbswt_1418
Accession: A0A0M3CCQ8
Uniprot status: Unreviewed
Organism: Sphingobacterium
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Sphingobacteriia ⇒ Sphingobacteriales ⇒ Sphingobacteriaceae ⇒ Sphingobacterium.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: LNLN CVV: 440 CHI: 0.6
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|A0A0M3CCQ8|A0A0M3CCQ8_9SPHI|Unreviewed|Sphingobacterium|86
MILENIIGITAGILTSISMLPQLLKVIKEKTVEDLSLPMIIILITGLSLWVWYGIIKNEL
PIIISNAFAVLVNLFLLSYYLRFKDK
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A0M3CCQ8_inward.pdb Alignment file: A0A0M3CCQ8_inw.pir Procheck score ⇒ Ramachandran plot: 94.1% favored 5.1% allowed .7% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0M3CCQ8_outward.pdb Alignment file: A0A0M3CCQ8_out.pir Procheck score ⇒ Ramachandran plot: 91.9% favored 7.4% allowed .7% week .0% disallowed Occluded: Model structure: A0A0M3CCQ8_occluded.pdb Alignment file: A0A0M3CCQ8_occ.pir Procheck score ⇒ Ramachandran plot: 93.4% favored 6.6% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA