| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0M0FLF6
dbSWEET id: dbswt_1415
Accession: A0A0M0FLF6
Uniprot status: Unreviewed
Organism: Leptospira kirschneri
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 96
Substrate Binding Site: VNVN CVV: 402 CHI: 1.4
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|A0A0M0FLF6|A0A0M0FLF6_9LEPT|Unreviewed|Leptospira kirschneri|96
MDSITFLGYIASLLTTISFLPQLIRILMGGSTKDISRNMYIVLVTGVLLWFIYGCLKQDF
PIILANAFTFLFAATILYFKLKSDFKVKLKNKSNEE
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A0M0FLF6_inward.pdb Alignment file: A0A0M0FLF6_inw.pir Procheck score ⇒ Ramachandran plot: 93.4% favored 5.1% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0M0FLF6_outward.pdb Alignment file: A0A0M0FLF6_out.pir Procheck score ⇒ Ramachandran plot: 96.3% favored 3.7% allowed .0% week .0% disallowed Occluded: Model structure: A0A0M0FLF6_occluded.pdb Alignment file: A0A0M0FLF6_occ.pir Procheck score ⇒ Ramachandran plot: 97.1% favored 2.9% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA