Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0M0C0T4
dbSWEET id: dbswt_2051
Accession: A0A0M0C0T4
Uniprot status: Unreviewed
Organism: miscellaneous Crenarchaeota
Kingdom: Archaea
Sequence Information back to top
Sequence length: 93
Substrate Binding Site: ININ CVV: 440 CHI: 2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|A0A0M0C0T4|A0A0M0C0T4_9ARCH|Unreviewed|miscellaneous Crenarchaeota|93
MDYITIIGLSAAAMGGIALFPQVLKVLKTRSTKDISREMILILAGSIFLWLVYGILLSNL
PIIIANFFGLIQAIIILFYKIKNQMKKMKPCEE
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A0M0C0T4_inward.pdb Alignment file: A0A0M0C0T4_inw.pir Procheck score ⇒ Ramachandran plot: 95.5% favored 3.0% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0M0C0T4_outward.pdb Alignment file: A0A0M0C0T4_out.pir Procheck score ⇒ Ramachandran plot: 94.8% favored 5.2% allowed .0% week .0% disallowed Occluded: Model structure: A0A0M0C0T4_occluded.pdb Alignment file: A0A0M0C0T4_occ.pir Procheck score ⇒ Ramachandran plot: 96.3% favored 3.7% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA