Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0M0C0T4

dbSWEET id: dbswt_2051

Accession:   A0A0M0C0T4

Uniprot status:   Unreviewed

Organism:   miscellaneous Crenarchaeota

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Candidatus Bathyarchaeota ⇒ MCG-6.

Sequence Information back to top


Sequence length:   93

Substrate Binding Site:   ININ           CVV:   440       CHI:   2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|A0A0M0C0T4|A0A0M0C0T4_9ARCH|Unreviewed|miscellaneous Crenarchaeota|93
MDYITIIGLSAAAMGGIALFPQVLKVLKTRSTKDISREMILILAGSIFLWLVYGILLSNL
PIIIANFFGLIQAIIILFYKIKNQMKKMKPCEE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0M0C0T4_inward.pdb    Alignment file: A0A0M0C0T4_inw.pir

Procheck score ⇒ Ramachandran plot: 95.5% favored    3.0% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0M0C0T4_outward.pdb    Alignment file: A0A0M0C0T4_out.pir

Procheck score ⇒ Ramachandran plot: 94.8% favored    5.2% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0M0C0T4_occluded.pdb    Alignment file: A0A0M0C0T4_occ.pir

Procheck score ⇒ Ramachandran plot: 96.3% favored    3.7% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur