Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0L9VH77

dbSWEET id: dbswt_110

Accession:   A0A0L9VH77

Uniprot status:   Unreviewed

Organism:   Phaseolus angularis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Vigna.

Sequence Information back to top


Sequence length:   279

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVN           CVV:   379       CHI:   4.1

Fasta sequence:

>tr|A0A0L9VH77|A0A0L9VH77_PHAAN|Unreviewed|Phaseolus_angularis|279
MAILGSHNPLAATFGIFGNIISFMVYLAPARTFQKIYKKKSTQSFQCLPYLVALFSSSLW
LYYASFNIKHSILLVSINSFGCVIEIIYIVIFIKYADKDAKKLTIKLLAAMNFGSLALIV
LVTRFAVDDSDQVKVLGWICDVVSVIVFAAPLSVVLQVIRTKSVQFMPFCLSFSLLLNAI
MWLAYGFFNKDMCVALPNVGGLALGLLQMLLHAIYRNRGAKENVTTDAAVTTFVVDVNPL
GPPEVFSTAVKDELSLEDNNKGGEDDAQGKTVETNDCPL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   217

Alignment file: A0A0L9VH77.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0L9VH77_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.4% favored    4.1% allowed    .5% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0L9VH77_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.9% favored    4.1% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0L9VH77_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    7.2% allowed    .5% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur