Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0L9V315
dbSWEET id: dbswt_629
Accession: A0A0L9V315
Uniprot status: Unreviewed
Organism: Phaseolus angularis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Vigna.
Sequence Information back to top
Sequence length: 235
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|A0A0L9V315|A0A0L9V315_PHAAN|Unreviewed|Phaseolus_angularis|235
MSLLGAYSICEVGKEAAGVAGNVFAFGLFLSPIPTFRRIIRNGSTEMFSGLPYVYSLLNC
LICLWYGTPLISPDNLLVTTVNTIGGVFQLVYITLFLIYAEKARKVRMLGLLLAVLGIFV
IILVGSLQIDDSAMRRMFVGLLSCASLISMFASPLFIIRLVIRTKSVEFMPFYLSLSTFL
MSISFFLYGLVSDDTFIYVPNGIGTVLGIVQLILYFYYKSSSTENCRQPLIVSNE
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 7 Model end: 220
Alignment file: A0A0L9V315.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0L9V315_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 6.5% allowed .0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0L9V315_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 5.9% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0L9V315_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 6.5% allowed .0% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA