| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0L9UES0
dbSWEET id: dbswt_557
Accession: A0A0L9UES0
Uniprot status: Unreviewed
Organism: Phaseolus angularis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Vigna.
Sequence Information back to top
Sequence length: 254
Substrate Binding Site: CNWS CVV: 418 CHI: -2.7
Selectivity Filter: LNLS CVV: 417 CHI: 3.3
Fasta sequence:
>tr|A0A0L9UES0|A0A0L9UES0_PHAAN|Unreviewed|Phaseolus_angularis|254
MAETIRLVVAVFGNAASMSLYAAPVVTFKRVIRKKSTEEFSCIPYIIGLLNCLLYTWYGL
PVVSCKWENFPIVTVNGVGIVLELSYVLIYFWFASRKGKVKVAMTAIPVVLLFCIIAAVS
AFAFHDTRHRKLLVGSIGLVVSVTLYGSPLVVMKKVIQTKSVEFMPLTLSVCAFLSSTLW
LIYGILIRDIFVAGPSILGTPLAILQLVLHCRYRKRSVVEEPGKGDQEKGNLEKVDMEIG
KVETNVTNHMTENS
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: A0A0L9UES0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0L9UES0_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.1% favored 7.9% allowed .5% week 1.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0L9UES0_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.8% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0L9UES0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 5.8% allowed 1.0% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA