Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0L9TK15
dbSWEET id: dbswt_168
Accession: A0A0L9TK15
Uniprot status: Unreviewed
Organism: Phaseolus angularis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Vigna.
Sequence Information back to top
Sequence length: 258
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVN CVV: 379 CHI: 4.1
Fasta sequence:
>tr|A0A0L9TK15|A0A0L9TK15_PHAAN|Unreviewed|Phaseolus_angularis|258
MAMHRESWAFVFGLLGNIISFGVFLAPLPTFYQIFKKKSTEGYQSLPYVVALFSAMLWIY
YAFVKREAALLLITINTFGIVVESIYLTIFLVYAPRKPRLTTIKLLLLLNVFGFGAMLLS
TLYLSKGAKRLAIIGWICLVFNISVFAAPLFIIRRVIKTRSVEYMPFTLSMFLTINAVMW
FFYGLLLRDYYVALPNTLGFLFGIIQMVMYLMYRNATPVALDEPVKAQEANGHIVGAVKM
GTIEPNHAGGGLGGVGKV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 215
Alignment file: A0A0L9TK15.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0L9TK15_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.2% allowed 1.0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0L9TK15_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.2% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0L9TK15_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 5.2% allowed 1.0% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22